Transcript | Ll_transcript_509715 |
---|---|
CDS coordinates | 184-702 (+) |
Peptide sequence | MEKNCKVCVTGSTGYIGSYLVKKLLDKGYTVHATLRDLKNESKVRLLKGLPHSEGKLLLFEADIYNPIDFEPAIQGCQFVFHVATPLAHEAGSQYKDSSEASLAGIKSIMMACERAGTVRRLIYTASVVSASPFKDHQSGFNDFMDETSWTPLNDSFAYLFLDHYHKVSLLF* |
ORF Type | complete |
Blastp | Dihydroflavonol 4-reductase from Petunia with 43.42% of identity |
---|---|
Blastx | Dihydroflavonol 4-reductase from Petunia with 43.42% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418611.1) |
Pfam | NAD dependent epimerase/dehydratase family (PF01370.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer