Protein coding transcript 50961

• Transcript: Ll_transcript_508029
• CDS coordinates: 42-623 (+)
• Peptide sequence: MVNLRTQKRLASAVAGCGKRKIWLDPNEVNEISNANSRATVRKLISDGLIIRKPVTMHSRSRARELTAARRIGRHRGTGKRKGTADARMPSQVMWMRRLRVLRRLLVKYRAAGKIDKHLYHELYHLSKGNTFKHKRALVEHIHKAKAEKARERAIQEEMDAKRAKTKAARERRQERVQNKRAAIEGEEEEAAQ*
• ORF Type: complete

Annotations of Ll_transcript_508029

• Blastp: 60S ribosomal protein L19-2 from Arabidopsis with 58.2% of identity
• Blastx: 60S ribosomal protein L19-A from Schizosaccharomyces with 71.88% of identity
• Eggnog: ribosomal protein L19(COG2147)
• Kegg: Link to kegg annotations (AT3G16780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004495933.1)
• Pfam: Ribosomal protein L19e (PF01280.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;