Transcript | Ll_transcript_510383 |
---|---|
CDS coordinates | 147-614 (+) |
Peptide sequence | MIMDMTKSTPLTWSHTISHSLHLPAPLFTTQARSFRVLCASHQTPKGNQMIISITGATGFIGRRLVQRLHADNHSVHVLTRSKSKAQEIFPVKDFPGIKIAGEPEWKDSIQGSTGVVNLAGLPISTRWSSEIKKEIKESRIRVTSKVSIHLQRIK* |
ORF Type | complete |
Blastp | Epimerase family protein SDR39U1 homolog, chloroplastic from Arabidopsis with 75.65% of identity |
---|---|
Blastx | Epimerase family protein SDR39U1 homolog, chloroplastic from Arabidopsis with 81.77% of identity |
Eggnog | Epimerase(COG1090) |
Kegg | Link to kegg annotations (AT2G21280) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003607078.1) |
Pfam | NAD dependent epimerase/dehydratase family (PF01370.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer