Protein coding transcript 50995

• Transcript: Ll_transcript_510383
• CDS coordinates: 147-614 (+)
• Peptide sequence: MIMDMTKSTPLTWSHTISHSLHLPAPLFTTQARSFRVLCASHQTPKGNQMIISITGATGFIGRRLVQRLHADNHSVHVLTRSKSKAQEIFPVKDFPGIKIAGEPEWKDSIQGSTGVVNLAGLPISTRWSSEIKKEIKESRIRVTSKVSIHLQRIK*
• ORF Type: complete

Annotations of Ll_transcript_510383

• Blastp: Epimerase family protein SDR39U1 homolog, chloroplastic from Arabidopsis with 75.65% of identity
• Blastx: Epimerase family protein SDR39U1 homolog, chloroplastic from Arabidopsis with 81.77% of identity
• Eggnog: Epimerase(COG1090)
• Kegg: Link to kegg annotations (AT2G21280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003607078.1)
• Pfam: NAD dependent epimerase/dehydratase family (PF01370.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;