Protein coding transcript 50998

• Transcript: Ll_transcript_510385
• CDS coordinates: 2190-2558 (+)
• Peptide sequence: MVPLFMMFAGGPLGSGKQWFSWIHLDDIVNLIYEALLNPSYKGVINGTAPNPVRLSELCEQLGYVLGRPSWLPVPDFALKAVLGEGASVVLEGQRVLPTQAKKLGFPFKYSYVKDALKAILS*
• ORF Type: complete

Annotations of Ll_transcript_510385

• Blastp: Epimerase family protein SDR39U1 homolog, chloroplastic from Arabidopsis with 81.82% of identity
• Blastx: Epimerase family protein SDR39U1 homolog, chloroplastic from Arabidopsis with 80.58% of identity
• Eggnog: Epimerase(COG1090)
• Kegg: Link to kegg annotations (AT2G21280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450999.1)
• Pfam: Domain of unknown function (DUF1731) (PF08338.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;