Protein coding transcript 51080

• Transcript: Ll_transcript_509284
• CDS coordinates: 119-622 (+)
• Peptide sequence: MASVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWVEEVRQERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKSRDFGIMFIETSAKAGFNIKVKIKGLS*
• ORF Type: complete

Annotations of Ll_transcript_509284

• Blastp: Ras-related protein RABH1e from Arabidopsis with 95% of identity
• Blastx: Ras-related protein RABH1e from Arabidopsis with 95% of identity
• Eggnog: member RAS oncogene family(ENOG410XPBI)
• Kegg: Link to kegg annotations (AT5G10260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459760.1)
• Pfam: ADP-ribosylation factor family (PF00025.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;