Protein coding transcript 51082

• Transcript: Ll_transcript_509289
• CDS coordinates: 1-447 (+)
• Peptide sequence: MYDKFDTTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWVEEVRQERGSDVIIVLVGNKPDLVDKRQVSIEEGDAKSRDFGIMFIETSAKAGFNIKPLFRKIAAALPGMETLSS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_509289

• Blastp: Ras-related protein RABH1e from Arabidopsis with 93.29% of identity
• Blastx: Ras-related protein RABH1e from Arabidopsis with 93.29% of identity
• Eggnog: member RAS oncogene family(ENOG410XPBI)
• Kegg: Link to kegg annotations (AT5G10260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459760.1)
• Pfam: Ras of Complex, Roc, domain of DAPkinase (PF08477.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;