Transcript | Ll_transcript_444900 |
---|---|
CDS coordinates | 193-753 (+) |
Peptide sequence | MRKSHGIIGIIGWGLILPVGAIIARYFRHKDPLWFHLHSVIQLVGFAFGLGTVLLGLQLYSKMHAHIPAHRGIGIFVLVLSILQILALFLRPNKDSKIRKMWNLYHSWFGRMALIFAAMNIVLGMQAAGAGNNWKISYGFLVSIIIVAVIILEVLAYLKRSENRSLHNFHMDPATQVPFPSNLPKG* |
ORF Type | complete |
Blastp | Cytochrome b561 and DOMON domain-containing protein At3g61750 from Arabidopsis with 57.24% of identity |
---|---|
Blastx | Cytochrome b561 and DOMON domain-containing protein At3g61750 from Arabidopsis with 61.29% of identity |
Eggnog | auxin-responsive protein(ENOG410Y10S) |
Kegg | Link to kegg annotations (AT3G61750) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424144.1) |
Pfam | Eukaryotic cytochrome b561 (PF03188.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer