Protein coding transcript 51165

• Transcript: Ll_transcript_510023
• CDS coordinates: 339-821 (+)
• Peptide sequence: MKGVMAMASQKVGEFTKDNPSWKSDNWQQNENNRNGLYQEYNQENSGWNSSSRGGQPSSVGQTNTYHSNSSDDWGLKDSRKEELAKGSSPQSSNTRNSSSWDDWDHEYPVKKEPAKGPASHTSDAWAGWDDGFDSRNASNNKTVGHNGKSDSAWTGGGFH*
• ORF Type: complete

Annotations of Ll_transcript_510023

• Blastp: Probable ADP-ribosylation factor GTPase-activating protein AGD6 from Arabidopsis with 40.36% of identity
• Blastx: Probable ADP-ribosylation factor GTPase-activating protein AGD6 from Arabidopsis with 48.53% of identity
• Eggnog: domain, ankyrin repeat and PH domain(COG5347)
• Kegg: Link to kegg annotations (AT3G53710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425865.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;