Protein coding transcript 51177

• Transcript: Ll_transcript_510027
• CDS coordinates: 1-471 (+)
• Peptide sequence: WEDDWGVDDGFGNSGDIRRNRSTGDFTRGGGGGMPVRSRSTTDFARSEWEASAANKESFFARKMAENESRSEELPPSKGGKYVGFGSSPTLSSQRSNQQNDYFSVVSQGIGKLSLVAASAAQEITSKVKEGGYDDKVNVVSQKTSEIGQKTWGIMKG
• ORF Type: internal

Annotations of Ll_transcript_510027

• Blastp: ADP-ribosylation factor GTPase-activating protein AGD7 from Arabidopsis with 61.76% of identity
• Blastx: ADP-ribosylation factor GTPase-activating protein AGD7 from Arabidopsis with 61.76% of identity
• Eggnog: domain, ankyrin repeat and PH domain(COG5347)
• Kegg: Link to kegg annotations (AT2G37550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440954.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;