Protein coding transcript 51179

• Transcript: Ll_transcript_510030
• CDS coordinates: 1-885 (+)
• Peptide sequence: WEDDWGVDDGFGNSGDIRRNRSTGDFTRGGGGGMPVRSRSTTDFARSEWEASAANKESFFARKMAENESRSEELPPSKGGKYVGFGSSPTLSSQRSNQQNDYFSVVSQGIGKLSLVAASAAQEITSKVKEGGYDGKVNETVTVVSQKTTEIGQKTWGIMKGVLALASQKVEELASDTPTSKTSNLQRNENDRNVNNQNFNQDNKGWNSSMGKEQSSSGQVKTHSSISSWDDWDNKDSKKEEPAKGSTSHDNDDWAGWDDDKDDGFDIFYEGASNRKGAGHNKKSDSTWTGGGFH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_510030

• Blastp: ADP-ribosylation factor GTPase-activating protein AGD7 from Arabidopsis with 55.23% of identity
• Blastx: Probable ADP-ribosylation factor GTPase-activating protein AGD6 from Arabidopsis with 49.84% of identity
• Eggnog: domain, ankyrin repeat and PH domain(COG5347)
• Kegg: Link to kegg annotations (AT2G37550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440954.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;