Protein coding transcript 512

• Transcript: Ll_transcript_471391
• CDS coordinates: 110-1003 (+)
• Peptide sequence: MGMNVITKHYSQTFLFLFILYVFFLHSISNADNTNLIFKGCAEKKLQDPSGICTKNLKSLLISLVSQSRQKPFYTTTSGENKNMIMGLYQCKGDLSNSSCYNCISKIDDMLDKLCGKVVAARVHLCGCYLRYEVVGFKQVPETHLLYKVCGSKQESEDNDNGIVEKRDMAFDMIESGVKNGGKLFYSGSYKSLNVLGQCDGDLASDDCGDCVKSAEDQAKTECGDSLSAQIYLNKCYISYNFKSNEMPKKSSFPGTALQQHTQKTIALVVGGFAALGFFAVCVLFLKSVLKKKDDMQ*
• ORF Type: complete

Annotations of Ll_transcript_471391

• Blastp: Cysteine-rich repeat secretory protein 56 from Arabidopsis with 50% of identity
• Blastx: Cysteine-rich repeat secretory protein 56 from Arabidopsis with 50% of identity
• Eggnog: cysteine-rich repeat secretory protein(ENOG410YTC3)
• Kegg: Link to kegg annotations (AT5G43980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427391.1)
• Pfam: Salt stress response/antifungal (PF01657.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;