Protein coding transcript 51269

• Transcript: Ll_transcript_508357
• CDS coordinates: 1-921 (+)
• Peptide sequence: QKNMTFNVYFVVGLISLLSSLSIVLTQGNDAITPEVPLLNRNTFPNGFIFGTASSSYQYEGAASEGGRGPSIWDTFTHKYPEKVKDGKNGDVAVDSYHRYKEDVAIMKDMNLDAYRFSISWSRILPKGKLSGGINQEGIAYYNNLINELIANGLQPLVTIFHWDLPQALEDEYGGFLSPLIVKDFQDYAELCFKEFGDRVKHWITLNEPWSFSQNGYALGHMAPGRCSAWLNRTCVGGDSAIEPYLVTHHQLLAHAAAVQVYKTKYQESQNGLIGITLIVTWSVPTSDNKFDQKAAERAIDFMYGW*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_508357

• Blastp: Cyanogenic beta-glucosidase from Trifolium with 73.51% of identity
• Blastx: Cyanogenic beta-glucosidase from Trifolium with 72.89% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000278)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448567.1)
• Pfam: Glycosyl hydrolase family 1 (PF00232.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;