Protein coding transcript 51295

• Transcript: Ll_transcript_510527
• CDS coordinates: 391-936 (+)
• Peptide sequence: MLEMEKDFDSKLKIQGDSSSNGGGGGNIQRSKSFAFRAPQENYSIQDFELGKIYGVGSYSKVVRAKKKDTGAVYALKIMDKKFITKENKTAYVKLERIVLDQLDHPGIVQLYFTFQDTFSLCKYIPRCIFLYTCLSYRVLLFAWFSMSFIFTPIVFQVALSNLIFVSFFLLFLLHWRRHGT*
• ORF Type: complete

Annotations of Ll_transcript_510527

• Blastp: 3-phosphoinositide-dependent protein kinase 2 from Arabidopsis with 77.34% of identity
• Blastx: 3-phosphoinositide-dependent protein kinase 2 from Arabidopsis with 77.34% of identity
• Eggnog: 3phosphoinositidedependent protein kinase(ENOG410XRT8)
• Kegg: Link to kegg annotations (AT3G10540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440991.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;