Protein coding transcript 514

• Transcript: Ll_transcript_400549
• CDS coordinates: 1-300 (+)
• Peptide sequence: NYPAPSHWRLLKMNAPEWVNAVLGVLGAIGSGAVQPIHAYCVGALISFYFDSQNSKAKSKTRTLALTFLGIGVFNFFASILQHYNFAIMGERLTKRIRKK
• ORF Type: internal

Annotations of Ll_transcript_400549

• Blastp: Putative multidrug resistance protein from Oryza sativa with 51.02% of identity
• Blastx: Putative multidrug resistance protein from Oryza sativa with 51.02% of identity
• Eggnog: (ABC) transporter(COG1132)
• Kegg: Link to kegg annotations (4328570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451695.1)
• Pfam: ABC transporter transmembrane region (PF00664.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;