Protein coding transcript 51415

• Transcript: Ll_transcript_510269
• CDS coordinates: 1489-1803 (+)
• Peptide sequence: MLPDKGSTVRTAAWTLSNLIKGPDPKAATELIRIDGVLDAIVRHLKKADDELATEVAWVVVYLSALSNVATGMLVKSDIIPLLVNRLAASNSLQLLIPGILSRF*
• ORF Type: complete

Annotations of Ll_transcript_510269

• Blastp: Importin subunit alpha-9 from Arabidopsis with 70.41% of identity
• Blastx: Importin subunit alpha-9 from Arabidopsis with 77.78% of identity
• Eggnog: importin subunit alpha(COG5064)
• Kegg: Link to kegg annotations (AT5G03070)
• CantataDB: Link to cantataDB annotations (CNT0002380)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428080.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;