Protein coding transcript 51433

• Transcript: Ll_transcript_510475
• CDS coordinates: 118-720 (+)
• Peptide sequence: MSEADEFRCFIGGLSWSTSDRKLKDTFEKYGRLVEAKVVVDKFSGRSRGFGFVTFDDKKAMEEAIDAMNGVDLDGRTITVDRAQPQQGSRDDGDRHRERGRDRGRDRDYGGGRGSNGGECFKCGKPGHFARECPSEGERGGRYGDRESRYGGRSGGPDRNADRSSGRRHRDADSHGDSGNDRYDRDRAGPYERRGSGGHR*
• ORF Type: complete

Annotations of Ll_transcript_510475

• Blastp: Glycine-rich RNA-binding protein RZ1A from Arabidopsis with 52.19% of identity
• Blastx: Glycine-rich RNA-binding protein RZ1A from Arabidopsis with 66.42% of identity
• Eggnog: Zinc knuckle(ENOG411219Q)
• Kegg: Link to kegg annotations (AT3G26420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419428.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;