Transcript | Ll_transcript_510487 |
---|---|
CDS coordinates | 987-1502 (+) |
Peptide sequence | MQVVVDKLSGRSRGFGFVTFDEKKAMDDAIDAMNGMDLDGRTITVDKAQPQQGSGRDDGDRYRDRDRGRDRGRDRDYGGGRGSNGGECFKCGKPGHFARECPSEGERGGRYGGRESKYGGSSAGGRYGPDRNGDRSSGGGRNRDAGSRGDSGNDRHHRDRDRDRAGPYERR* |
ORF Type | complete |
Blastp | Glycine-rich RNA-binding protein RZ1A from Arabidopsis with 52.31% of identity |
---|---|
Blastx | Glycine-rich RNA-binding protein RZ1A from Arabidopsis with 70.48% of identity |
Eggnog | Zinc knuckle(ENOG411219Q) |
Kegg | Link to kegg annotations (AT3G26420) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441025.1) |
Pfam | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer