Protein coding transcript 51451

• Transcript: Ll_transcript_508926
• CDS coordinates: 531-1058 (+)
• Peptide sequence: MGNTSSMLTQYDIEEVQQNCKHAFTQQEIVSLYQRFCQLDRNKCGFISSDEFMSIPEFAVNPLSHSLLTMLDGFNFKEFVAFLSTFSSRASLQHKIEFIFKVYDSDCNGKVTFDDMSRVLRDLSGQFMSQQQREEVLAQVLEDAGYNKDSFLVLSDFMKIFGNSELKMEAEIPVD*
• ORF Type: complete

Annotations of Ll_transcript_508926

• Blastp: Calcineurin subunit B from Naegleria with 36.16% of identity
• Blastx: Calcineurin subunit B from Naegleria with 36.63% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453680.1)
• Pfam: EF-hand domain pair (PF13499.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;