Protein coding transcript 51456

• Transcript: Ll_transcript_508936
• CDS coordinates: 2-634 (+)
• Peptide sequence: RVSYSELEKTNQEIQKRNQINSLSEVKLQEVSKYKFDKLVIATNNFNLTNKLGEGGFGPVYKGTLEDGQEIAVKRLSSASGQGLEEFMNEVIVISKLQHLNLVRLLGCCTDGDEKILIYEYMPNRSLDAYMFGPVGEVLSWEKRFKILEGIARGLLYLHRDSRLRIIHRDLKLSNILLDEELNPKISDFGTARIFGRSEDAANTNRVVGT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_508936

• Blastp: G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330 from Arabidopsis with 69.15% of identity
• Blastx: G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330 from Arabidopsis with 69.15% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G11330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419845.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;