Protein coding transcript 51460

• Transcript: Ll_transcript_508943
• CDS coordinates: 344-1180 (+)
• Peptide sequence: MSFDHFRNLKILIMFSCFIHVGTSLDTISSSKFLKDTETLSSNDGLFKLGFFTPTNSTFSYLGIWYNMAKPQVVWVANRDNPLKNSSSGRLKISEDGNLVVMSEQNQVLWTTNVSSIAASNSTTAQLQNSGNLVLQETSSGSMLWQSFQHPCDTLLQQMKLTLNKTNGEKTELTSWRSPQDPSIGEFSASLDRLSIPEVFVWRGEQQYWRSGPWNGQIFLGTPGMNTVYLSGFILGGLDEREDSFYLSYTYPNKSDLLIYVLSPKGILHEVHWNYEQSN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_508943

• Blastp: Putative G-type lectin S-receptor-like serine/threonine-protein kinase At1g61610 from Arabidopsis with 39.36% of identity
• Blastx: Putative G-type lectin S-receptor-like serine/threonine-protein kinase At1g61610 from Arabidopsis with 39.36% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G61610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419845.1)
• Pfam: D-mannose binding lectin (PF01453.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;