Protein coding transcript 51490

• Transcript: Ll_transcript_510093
• CDS coordinates: 3328-3810 (+)
• Peptide sequence: MVERDTGRPRGFGFITFADRRGMEDAMKEMHGRELGDRAISVNRAQPKMGSDDADHGYRSSYSSGGRGNYRVGDSTGQDDCFKCGRPGHWARDCPMAGGGRGGGGSFLSRPRFEAAGGHGDRLSNERDRYADDRYDGRRYGDGGRYDDRYGSHDRHPSDR*
• ORF Type: complete

Annotations of Ll_transcript_510093

• Blastp: Glycine-rich RNA-binding protein RZ1C from Arabidopsis with 52.22% of identity
• Blastx: Glycine-rich RNA-binding protein RZ1B from Arabidopsis with 54.4% of identity
• Eggnog: Rna-binding protein(COG0724)
• Kegg: Link to kegg annotations (AT5G04280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449815.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;