Transcript | Ll_transcript_510093 |
---|---|
CDS coordinates | 3328-3810 (+) |
Peptide sequence | MVERDTGRPRGFGFITFADRRGMEDAMKEMHGRELGDRAISVNRAQPKMGSDDADHGYRSSYSSGGRGNYRVGDSTGQDDCFKCGRPGHWARDCPMAGGGRGGGGSFLSRPRFEAAGGHGDRLSNERDRYADDRYDGRRYGDGGRYDDRYGSHDRHPSDR* |
ORF Type | complete |
Blastp | Glycine-rich RNA-binding protein RZ1C from Arabidopsis with 52.22% of identity |
---|---|
Blastx | Glycine-rich RNA-binding protein RZ1B from Arabidopsis with 54.4% of identity |
Eggnog | Rna-binding protein(COG0724) |
Kegg | Link to kegg annotations (AT5G04280) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449815.1) |
Pfam | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer