| Transcript | Ll_transcript_471388 |
|---|---|
| CDS coordinates | 1-303 (+) |
| Peptide sequence | HSSFASDVLDFTDDDFSTRIAEHESVLVMFYAPWCGHCKKLKPEFERAAGMLAGNDPPVALAKVDCTEGGKSTCNKFSVSGYPTPKIFKVGEFSQEYNGPR |
| ORF Type | internal |
| Blastp | Protein disulfide-isomerase A3 from Bos with 59.6% of identity |
|---|---|
| Blastx | Protein disulfide-isomerase A3 from Bos with 59.6% of identity |
| Eggnog | Thioredoxin(COG0526) |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_015934571.1) |
| Pfam | Thioredoxin (PF00085.19) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer