Protein coding transcript 51661

• Transcript: Ll_transcript_509657
• CDS coordinates: 213-524 (+)
• Peptide sequence: MLPSADEAQRLGGLLQNCKVRNFRNSGHTILLEDGIGLLTIIKATSMYRQSRRLDLVRDFIPPSMTEFRYIMDEVVGLFRSLIGSVMFSTLEDGTIVKGLSGVP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_509657

• Blastp: Acyltransferase-like protein At1g54570, chloroplastic from Arabidopsis with 63.46% of identity
• Blastx: Acyltransferase-like protein At1g54570, chloroplastic from Arabidopsis with 67.79% of identity
• Eggnog: Acyltransferase(COG0204)
• Kegg: Link to kegg annotations (AT1G54570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440518.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;