Transcript | Ll_transcript_509643 |
---|---|
CDS coordinates | 248-1276 (+) |
Peptide sequence | MPSLVKGFQFSPLSAIISWRSRRPMLIFQAQSFDGVRNSTMNVNDRGSCYVNVEDKIEEDKIVNSNILEEEEKIRAVWNDGYGSRSVEDYFDAAKEMSKFSDCGPPRWICPLDCAGPFKNSPTLLFLPGIDGTGLGLTLHHKALGKVFKVHCLHIPAHDRTPFEGLVKLVEEAIKLEYVLSPNKPIYMVGESLGGCLALAVAARNPTIDLVLILVNPATSFGRSQLQPLLPILEVMPDELHATVSFLLGFIVGDPVKMASVNVGNSLPPTEKVEQLSNNLTALLTYLPELADIIPRDTLLWKLKLLKSAASYANSRLHAVKAEVLVLARFSLTLDLMALIES* |
ORF Type | complete |
Blastp | Acyltransferase-like protein At1g54570, chloroplastic from Arabidopsis with 57.41% of identity |
---|---|
Blastx | Acyltransferase-like protein At1g54570, chloroplastic from Arabidopsis with 58.4% of identity |
Eggnog | Acyltransferase(COG0204) |
Kegg | Link to kegg annotations (AT1G54570) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440518.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer