Protein coding transcript 51670

• Transcript: Ll_transcript_509649
• CDS coordinates: 7-1194 (+)
• Peptide sequence: MASSLLMGFKVSPFSTPISLKTHPFQIQPHSFNIQTKSTLHHNNNNHSYSLVADTDIHQNDSLLQPIIEQDKNLNFNTTTTTNVSEENDDEEEDLAPLWNDGYGTKTIQDFIAEAKEKNKVDNGGPPSWFSPNDCGPPLKNSPTLLFLPGIDGTGLGLTLHHKALGKAFHVRCLHIPVQDRTPFEGLVKLVEEAVKLEHASSPKKPIYLVGDSIGGSLALAVAARNPTIDLVLILVNPATSFDRSQLQPLFPILEVLPDELHAAIPLRSLILGDPVKLASVNIGNSLPPVKRFEQLSYNLATLLPSLHELENIILPKDTLLWKLKLMKSAASYANAHLRSVKAEVLVLASGKDNMFPSVDEAQRLVQSLQNCKFRNFKDSGHYLLLVCRPTVSGR*
• ORF Type: complete

Annotations of Ll_transcript_509649

• Blastp: Acyltransferase-like protein At1g54570, chloroplastic from Arabidopsis with 62.84% of identity
• Blastx: Acyltransferase-like protein At1g54570, chloroplastic from Arabidopsis with 63.92% of identity
• Eggnog: Acyltransferase(COG0204)
• Kegg: Link to kegg annotations (AT1G54570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419255.1)
• Pfam: Serine aminopeptidase, S33 (PF12146.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;