Protein coding transcript 51745

• Transcript: Ll_transcript_508536
• CDS coordinates: 940-1650 (+)
• Peptide sequence: MQHSDKATTVSPTYSREVAGHPAVAPHLHKFHGIINGIDPDIWDPYNDNCIPVPYTSDNVVEGKRASKEALQLRLGLEKANLPLVGIITRLTHQKGIHLIKHAIWRTLERGGQIVLLGSAPDPRIQNDFVSLANQLHSTHNARARLCLSYDEPLSHLIYAGADFILVPSIFEPCGLTQLTAMRYGSIPVVRKTGGLYDTVFDVDHDKDRAQAEGLAPNGFGFDGADAGGVDYALNR*
• ORF Type: complete

Annotations of Ll_transcript_508536

• Blastp: Soluble starch synthase 3, chloroplastic/amyloplastic from Solanum with 85.17% of identity
• Blastx: Soluble starch synthase 3, chloroplastic/amyloplastic from Solanum with 80.73% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439824.1)
• Pfam: Glycosyl transferases group 1 (PF00534.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;