Transcript | Ll_transcript_508536 |
---|---|
CDS coordinates | 940-1650 (+) |
Peptide sequence | MQHSDKATTVSPTYSREVAGHPAVAPHLHKFHGIINGIDPDIWDPYNDNCIPVPYTSDNVVEGKRASKEALQLRLGLEKANLPLVGIITRLTHQKGIHLIKHAIWRTLERGGQIVLLGSAPDPRIQNDFVSLANQLHSTHNARARLCLSYDEPLSHLIYAGADFILVPSIFEPCGLTQLTAMRYGSIPVVRKTGGLYDTVFDVDHDKDRAQAEGLAPNGFGFDGADAGGVDYALNR* |
ORF Type | complete |
Blastp | Soluble starch synthase 3, chloroplastic/amyloplastic from Solanum with 85.17% of identity |
---|---|
Blastx | Soluble starch synthase 3, chloroplastic/amyloplastic from Solanum with 80.73% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439824.1) |
Pfam | Glycosyl transferases group 1 (PF00534.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer