Protein coding transcript 51750

• Transcript: Ll_transcript_508520
• CDS coordinates: 940-1782 (+)
• Peptide sequence: MQHSDKATTVSPTYSREVAGHPAVAPHLHKFHGIINGIDPDIWDPYNDNCIPVPYTSDNVVEGKRASKEALQLRLGLEKANLPLVGIITRLTHQKGIHLIKHAIWRTLERGGQIVLLGSAPDPRIQNDFVSLANQLHSTHNARARLCLSYDEPLSHLIYAGADFILVPSIFEPCGLTQLTAMRYGSIPVVRKTGGLYDTVFDVDHDKDRAQAEGLAPNGFGFDGADAGGVDYALNRAISAWYEGRDWFNSLCKKVMEQDWSWNRPALDYLELYHAARKSL*
• ORF Type: complete

Annotations of Ll_transcript_508520

• Blastp: Soluble starch synthase 3, chloroplastic/amyloplastic from Solanum with 86.33% of identity
• Blastx: Soluble starch synthase 3, chloroplastic/amyloplastic from Solanum with 82.22% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439824.1)
• Pfam: Glycosyl transferases group 1 (PF00534.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;