| Transcript | Ll_transcript_508527 |
|---|---|
| CDS coordinates | 1844-2143 (+) |
| Peptide sequence | MRYGSIPVVRKTGGLYDTVFDVDHDKDRAQAEGLAPNGFGFDGADAGGVDYALNRAISAWYEGRDWFNSLCKKVMEQDWSWNRPALDYLELYHAARKSL* |
| ORF Type | complete |
| Blastp | Soluble starch synthase 3, chloroplastic/amyloplastic from Solanum with 91.75% of identity |
|---|---|
| Blastx | Soluble starch synthase 3, chloroplastic/amyloplastic from Solanum with 88.5% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019439824.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer