| Transcript | Ll_transcript_530694 |
|---|---|
| CDS coordinates | 3-308 (+) |
| Peptide sequence | LLDDIYQWATQFGDRIDETEEMLTDNRIWIGRTKGVGVVSAADAINYSFSGVMLRGSGVPWDVRKSQPYDAYDRVDFDVPVGVNGDCYDRYLCRMEEFRQSL |
| ORF Type | internal |
| Blastp | - |
|---|---|
| Blastx | NADH-ubiquinone oxidoreductase 49 kDa subunit, mitochondrial from Neurospora with 88.24% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (NCU02534) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (YP_009237626.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer