Protein coding transcript 5180

• Transcript: Ll_transcript_351786
• CDS coordinates: 337-867 (+)
• Peptide sequence: MHVLMDMELKPDEVEDVKGTLCYMIKNRFPSGNYPSSEGNESDRLVHWCHGAPGVTLTLVKAAEVFGDKEFSQAAIDAGDVVWKRGLLKRVGMCHGISGNTYAFLSLYRLTGNVEYLYRAKAFACFLLDRAQRLISEGNMHGGDRPYSLFEGLGGMAYTFLDMIDPQGAKFPGYEL*
• ORF Type: complete

Annotations of Ll_transcript_351786

• Blastp: LanC-like protein GCR2 from Arabidopsis with 76.7% of identity
• Blastx: LanC-like protein GCR2 from Arabidopsis with 77.17% of identity
• Eggnog: glutathione binding(ENOG410XQIA)
• Kegg: Link to kegg annotations (AT1G52920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425407.1)
• Pfam: Lanthionine synthetase C-like protein (PF05147.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;