Protein coding transcript 51827

• Transcript: Ll_transcript_508008
• CDS coordinates: 92-562 (+)
• Peptide sequence: MLFSNMSLLTPTELQKIFEKMDKNGDGFVSLEELNWLLQKIGFHFSLDEVESIVEKKSLDLSEFLFFYNSISKQNNDETRNDGDENDHDHDLVETFKVFDIDGDGFITSHELECVLKRLGLWDGKDCRSMICFYDTNLDGQLDFEEFKNMMLLNIS*
• ORF Type: complete

Annotations of Ll_transcript_508008

• Blastp: Probable calcium-binding protein CML44 from Arabidopsis with 45.33% of identity
• Blastx: Probable calcium-binding protein CML44 from Arabidopsis with 45.33% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (AT1G21550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436131.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;