Protein coding transcript 51830

• Transcript: Ll_transcript_508014
• CDS coordinates: 1619-2356 (+)
• Peptide sequence: MYLLILNKFSEIRVPMVPKISSCLYNRRLEILPSKDWELESIHTLEILDIIKEHVTNVTGLRANSSVTESWATTEVRHVLLGQVYVASILYGYFLKSVSLRYRLERNLSNNDLRLGHRAALSFNDMCRNGLKDSIFGGSSNMQSTGQGLVKQEEENEDLKCYVMRIHTESLQKCDKFRSKEGVNLVGNYTCALFNNDESGLVENDDVILTSFSSLKRLVLEAVAFGTFLWETEDYIDNLYKLKNN*
• ORF Type: complete

Annotations of Ll_transcript_508014

• Blastp: UV-B-induced protein At3g17800, chloroplastic from Arabidopsis with 31.13% of identity
• Blastx: UV-B-induced protein At3g17800, chloroplastic from Arabidopsis with 32% of identity
• Eggnog: Protein of unknown function (DUF760)(ENOG410YDXB)
• Kegg: Link to kegg annotations (AT3G17800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463233.1)
• Pfam: Protein of unknown function (DUF760) (PF05542.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;