Transcript | Ll_transcript_508021 |
---|---|
CDS coordinates | 1622-2359 (+) |
Peptide sequence | MYLLILNKFSEIRVPMVPKISSCLYNRRLEILPSKDWELESIHTLEILDIIKEHVTNVTGLRANSSVTESWATTEVRHVLLGQVYVASILYGYFLKSVSLRYRLERNLSNNDLRLGHRAALSFNDMCRNGLKDSIFGGSSNMQSTGQGLVKQEEENEDLKCYVMRIHTESLQKCDKFRSKEGVNLVGNYTCALFNNDESGLVENDDVILTSFSSLKRLVLEAVAFGTFLWETEDYIDNLYKLKNN* |
ORF Type | complete |
Blastp | UV-B-induced protein At3g17800, chloroplastic from Arabidopsis with 31.13% of identity |
---|---|
Blastx | UV-B-induced protein At3g17800, chloroplastic from Arabidopsis with 32% of identity |
Eggnog | Protein of unknown function (DUF760)(ENOG410YDXB) |
Kegg | Link to kegg annotations (AT3G17800) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463233.1) |
Pfam | Protein of unknown function (DUF760) (PF05542.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer