Protein coding transcript 51848

• Transcript: Ll_transcript_508462
• CDS coordinates: 1586-2062 (+)
• Peptide sequence: MLQVTDPWFAVFAFLYIATQIQHLIEVLSGGGSITMWWDEQRIWILKSVTSLFAITEAIKKWLGLNKKKFSLSNKAIDKENLKKYEQGRFNFQGAALYMSPMVVLLIVNIVCFFGGLWRLVKVKDFEDMFGQLFLLSYVIVLSYPILEAIVTMKSKSG*
• ORF Type: complete

Annotations of Ll_transcript_508462

• Blastp: Cellulose synthase-like protein G2 from Arabidopsis with 31.13% of identity
• Blastx: Cellulose synthase-like protein G3 from Arabidopsis with 30.7% of identity
• Eggnog: Glycosyl transferase, family 2(COG1215)
• Kegg: Link to kegg annotations (AT4G24000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412953.1)
• Pfam: Cellulose synthase (PF03552.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;