Protein coding transcript 51901

• Transcript: Ll_transcript_507999
• CDS coordinates: 121-774 (+)
• Peptide sequence: MKHWWFFQVLLVVSVTLERGIHVEAAEEGFVKARGVQLMLNGSPYYANGFNAYWLMYVASDPSQRNKVTSTFQEAANHGLNIARTWAFSDGGYKPLQNSPGSYNEEMFQGLDFAIAEARKYGIKLVLSLVNNYESLGGKKQYVDWARSQGQYSINSEDDFFTNSVVKGYYKNHIKSVLTRQNSLTGVAYKDDPTIMAWELMNEIRCPSDQSGNTVQV*
• ORF Type: complete

Annotations of Ll_transcript_507999

• Blastp: Mannan endo-1,4-beta-mannosidase 7 from Arabidopsis with 72.49% of identity
• Blastx: Mannan endo-1,4-beta-mannosidase 7 from Arabidopsis with 72.87% of identity
• Eggnog: Mannan endo-1,4-beta-mannosidase(COG3934)
• Kegg: Link to kegg annotations (AT5G66460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432491.1)
• Pfam: Cellulase (glycosyl hydrolase family 5) (PF00150.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;