Transcript | Ll_transcript_508649 |
---|---|
CDS coordinates | 110-1132 (+) |
Peptide sequence | MAVQAQYPPNILLLNRNGQEGNDYSLQQTQSKVELLDQSQSLYNNENANSRKRGRDAIVTNPSPNNIMNPLFSMQPHPLKFIELSQLHNQHQNVVSTGLGLSFGDQQKQRLQLHQQPQQQQLHGCYSSSYLSLLSEGFSSQMKRQRDEIDQFLHAQGDELQRTLAEKRQKHCQALSRAAAEVVARLLREKEAEMEKATRQNAELEAHAARLSAEAQMWQAKVRAQEAAAVSLQAQLQQTMMALGAGGCHGGDGGGAGLSCAMDDGQAEDAESAYIDPDRVEVIAPVEAARAKCRGCGKRVASVVVLPCRHLCMCAECDTHFKACPVCHILKNSTIEVLIS* |
ORF Type | complete |
Blastp | E3 ubiquitin-protein ligase BOI from Arabidopsis with 30.73% of identity |
---|---|
Blastx | BOI-related E3 ubiquitin-protein ligase 1 from Arabidopsis with 28.57% of identity |
Eggnog | protein binding zinc ion binding(ENOG4111S1X) |
Kegg | Link to kegg annotations (AT4G19700) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420281.1) |
Pfam | Zinc finger, C3HC4 type (RING finger) (PF13920.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer