Transcript | Ll_transcript_351812 |
---|---|
CDS coordinates | 82-1005 (+) |
Peptide sequence | MAATPFLILQPRFNSYINPLFRSLSSSPLSFNAATAIQSSLSPPSDTHSSTAAGRSGALSPAPPLSGAVQKIDVNPPKGTRDFPPEDMRLRNWLFNNFREVSRLYAFEEVDFPVLENEALFTRKAGEEIKDQLYCFEDQGKRRVALRPELTPSLARLVIQKGKSVSLPLKWFTVGQCWRYERMTRGRRREHYQWNMDIIGVPGVMAEAELIASIVTLFKRIGITESDVGFKVSSRKVLQGVLKCYSIPENLFGKVCVIIDKIEKIPAEEIKKELKVAGVSEEAVHELLEVLSVKSLAELEGSPSTVN* |
ORF Type | complete |
Blastp | Histidine--tRNA ligase, chloroplastic/mitochondrial from Arabidopsis with 74.54% of identity |
---|---|
Blastx | Histidine--tRNA ligase, chloroplastic/mitochondrial from Arabidopsis with 78.8% of identity |
Eggnog | Histidyl-trna synthetase(COG0124) |
Kegg | Link to kegg annotations (AT3G46100) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456673.1) |
Pfam | Histidyl-tRNA synthetase (PF13393.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer