Protein coding transcript 520

• Transcript: Ll_transcript_530710
• CDS coordinates: 1-321 (+)
• Peptide sequence: IKYFSRPEIDDWECRKAMNDIMMEDLVADPKIIIAALHACRRLNDYAMGVRFLEACKWKCGSAVNEIYPYILQEIRPTLDELGMNTPEELGYDKPDMYLPITDEVH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_530710

• Blastp: Cytochrome c oxidase subunit 5A, mitochondrial from Notamacropus with 63.16% of identity
• Blastx: Cytochrome c oxidase subunit 5A, mitochondrial from Notamacropus with 63.16% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001242246.1)
• Pfam: Cytochrome c oxidase subunit Va (PF02284.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;