Transcript | Ll_transcript_508142 |
---|---|
CDS coordinates | 177-566 (+) |
Peptide sequence | MAKNEELPIPIYNNLEPVYGDGSQLEEAKLRFDNLKSKFLQVFGHSPQLFARSPGRVNLIGEHIDYEGYSVLPMAIRQDTIIAIRRNETQKVLRIANVNEKYSMCTYPTDPNQELDLKNHKWGHYFICG* |
ORF Type | complete |
Blastp | Galactokinase from Arabidopsis with 78.29% of identity |
---|---|
Blastx | Galactokinase from Arabidopsis with 78.29% of identity |
Eggnog | Catalyzes the transfer of the gamma-phosphate of ATP to D-galactose to form alpha-D-galactose-1-phosphate (Gal-1-P) (By similarity)(COG0153) |
Kegg | Link to kegg annotations (AT3G06580) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463272.1) |
Pfam | Galactokinase galactose-binding signature (PF10509.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer