Protein coding transcript 52010

• Transcript: Ll_transcript_508142
• CDS coordinates: 177-566 (+)
• Peptide sequence: MAKNEELPIPIYNNLEPVYGDGSQLEEAKLRFDNLKSKFLQVFGHSPQLFARSPGRVNLIGEHIDYEGYSVLPMAIRQDTIIAIRRNETQKVLRIANVNEKYSMCTYPTDPNQELDLKNHKWGHYFICG*
• ORF Type: complete

Annotations of Ll_transcript_508142

• Blastp: Galactokinase from Arabidopsis with 78.29% of identity
• Blastx: Galactokinase from Arabidopsis with 78.29% of identity
• Eggnog: Catalyzes the transfer of the gamma-phosphate of ATP to D-galactose to form alpha-D-galactose-1-phosphate (Gal-1-P) (By similarity)(COG0153)
• Kegg: Link to kegg annotations (AT3G06580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463272.1)
• Pfam: Galactokinase galactose-binding signature (PF10509.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;