Protein coding transcript 52028

• Transcript: Ll_transcript_507884
• CDS coordinates: 500-976 (+)
• Peptide sequence: MVLIFVVFRWDYIRDGPNLLKNMDRLEAYNKGLTTWSRWVDLNVDPTKTKVFFQGISPTHYLGKEWNQPKKSCSGELEPLPGSTYPAGLPPSTTIVNNVLKKMKNPVYLLDITLLSQLRKDAHPSSYSGDHAGNDCSHWCLPGLPDTWNLLLYAALTN*
• ORF Type: complete

Annotations of Ll_transcript_507884

• Blastp: Protein trichome birefringence-like 38 from Arabidopsis with 71.62% of identity
• Blastx: Protein trichome birefringence-like 38 from Arabidopsis with 71.62% of identity
• Eggnog: function domain containing protein, expressed(ENOG410YAJT)
• Kegg: Link to kegg annotations (AT1G29050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440211.1)
• Pfam: GDSL/SGNH-like Acyl-Esterase family found in Pmr5 and Cas1p (PF13839.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;