Protein coding transcript 52031

• Transcript: Ll_transcript_507874
• CDS coordinates: 131-931 (+)
• Peptide sequence: MGFSFRVYYLFLLSLFMSLHQPRAERFYNVSGTRGRKTIVSGCNLFIGNWVIDPSYPLYDSSSCPFIDAEFDCQKYGRPDKQYLKYAWKPDSCALPRFDGVDFLKRWKGKKIMFVGDSLSLNMWESLSCMIHASVPDSKTSFSRKEALSSVTFQDYGVTIQLYRTPYLVDIVREDVGRVLNLDSIVAANAWKGMDMLIFNSWHWWTHVGISQGWDYIRDGPNLLKNMDRLEAYNKGLTTWSRWVDLNVDPTKTKVFFQGISPTHYL*
• ORF Type: complete

Annotations of Ll_transcript_507874

• Blastp: Protein trichome birefringence-like 37 from Arabidopsis with 69.79% of identity
• Blastx: Protein trichome birefringence-like 37 from Arabidopsis with 69.79% of identity
• Eggnog: function domain containing protein, expressed(ENOG410YAJT)
• Kegg: Link to kegg annotations (AT2G34070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440211.1)
• Pfam: PMR5 N terminal Domain (PF14416.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;