Transcript | Ll_transcript_507880 |
---|---|
CDS coordinates | 325-1128 (+) |
Peptide sequence | MGFNFRVYSLFLLSLFLSLHQAITAEKYYNVSGIRGRKAISGCNLFIGNWVVDPSFPLYDSSSCPFIDAQFDCQKYGRPDKQYLKYAWKPDSCALPRFDGVDLLKRWKEKKIMFVGDSLSLNMWESLCCMIHASVPNTKTSFLRKEALSSVIFQDYGVTIHLYRTPYLVDIVPEDVGRVLTLGSIVAGNSWKNMDFLIFNSWHWWTHNGSKSQGWDYIRDGPNLVKDMDRLEAYSKGLTTWSRWVDLNVDPTKTKVFFQGISPTHYQ* |
ORF Type | complete |
Blastp | Protein trichome birefringence-like 37 from Arabidopsis with 69.23% of identity |
---|---|
Blastx | Protein trichome birefringence-like 37 from Arabidopsis with 69.23% of identity |
Eggnog | function domain containing protein, expressed(ENOG410YAJT) |
Kegg | Link to kegg annotations (AT2G34070) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420009.1) |
Pfam | PMR5 N terminal Domain (PF14416.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer