| Transcript | Ll_transcript_507886 |
|---|---|
| CDS coordinates | 44-496 (+) |
| Peptide sequence | MGFKVYNLCLFFLFCQQALVAVSKHHNVTLLRGKKEVSWCNLFIGSWVIDPSYPLYDSASCPFIDAEFDCQKFGRPDKQYLKYSWKPDSCALPRFDGVDFLNRWRGKKIMFVGDSLSLNMWESLCCMIHASVPNTKTSFLRKEALSSVIFQ |
| ORF Type | 3prime_partial |
| Blastp | - |
|---|---|
| Blastx | Protein trichome birefringence-like 37 from Arabidopsis with 68.15% of identity |
| Eggnog | function domain containing protein, expressed(ENOG410YAJT) |
| Kegg | Link to kegg annotations (AT2G34070) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019445733.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer