Protein coding transcript 52054

• Transcript: Ll_transcript_510180
• CDS coordinates: 2-316 (+)
• Peptide sequence: EDTERKGEGEKKMVSLKLQKRLAASVLKCGGGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARRVKEAKRKGRHSGYGIRFVRNVNHFLLK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_510180

• Blastp: 60S ribosomal protein L19-2 from Arabidopsis with 87.65% of identity
• Blastx: 60S ribosomal protein L19-3 from Arabidopsis with 95.79% of identity
• Eggnog: ribosomal protein L19(COG2147)
• Kegg: Link to kegg annotations (AT3G16780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001241295.1)
• Pfam: Ribosomal protein L19e (PF01280.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;