Transcript | Ll_transcript_508047 |
---|---|
CDS coordinates | 1956-2912 (+) |
Peptide sequence | MSKGVADMKDFGFFGKNFNGLPDEVFNDIVNFFDFPLEDVEINVDEDWDAQFKRLEEPCFDVFPVASSGMCGRTENNPQLGISFSTSYNGVSQIKQQLAQTAGPTYGKTISDPNDSIGKHLHRFQTTSPVSVFDSSNSSSSAENSNVEQPTICVKRSRSKRQRPSSSSSVFAISFIPTSHALQEYPETDTSLMKLRNKVEKQNEKDLFLVSDQVKMKRYSSKDSVVTRKCMHCEAKKTPQWREGPMGPKTLCNACGVRYRSGRLYPEYRPAVSPTFVPSLHSNNHKKVVEMRSKAMQEAVRGSMLSSSSFSRNSVINV* |
ORF Type | complete |
Blastp | GATA transcription factor 11 from Arabidopsis with 38.41% of identity |
---|---|
Blastx | GATA transcription factor 11 from Arabidopsis with 37.99% of identity |
Eggnog | Transcription factor(COG5641) |
Kegg | Link to kegg annotations (AT1G08010) |
CantataDB | Link to cantataDB annotations (CNT0002691) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436280.1) |
Pfam | GATA zinc finger (PF00320.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer