Protein coding transcript 52094

• Transcript: Ll_transcript_508050
• CDS coordinates: 2282-3280 (+)
• Peptide sequence: MYVLILFYFTHCNILNQGVADMKDFGFFGKNFNGLPDEVFNDIVNFFDFPLEDVEINVDEDWDAQFKRLEEPCFDVFPVASSGMCGRTENNPQLGISFSTSYNGVSQIKQQLAQTAGPTYGKTISDPNDSIGKHLHRFQTTSPVSVFDSSNSSSSAENSNVEQPTICVKRSRSKRQRPSSSSSVFAISFIPTSHALQEYPETDTSLMKLRNKVEKQNEKDLFLVSDQVKMKRYSSKDSVVTRKCMHCEAKKTPQWREGPMGPKTLCNACGVRYRSGRLYPEYRPAVSPTFVPSLHSNNHKKVVEMRSKAMQEAVRGSMLSSSSFSRNSVINV*
• ORF Type: complete

Annotations of Ll_transcript_508050

• Blastp: GATA transcription factor 11 from Arabidopsis with 38.41% of identity
• Blastx: GATA transcription factor 11 from Arabidopsis with 37.99% of identity
• Eggnog: Transcription factor(COG5641)
• Kegg: Link to kegg annotations (AT1G08010)
• CantataDB: Link to cantataDB annotations (CNT0002691)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436280.1)
• Pfam: GATA zinc finger (PF00320.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;