Protein coding transcript 521

• Transcript: Ll_transcript_334167
• CDS coordinates: 2-361 (+)
• Peptide sequence: RPKNFGIGQDIQPTRDLSRFVKWPKYIRIQRQKAVLQKRLKVPPPINQFSQTLDKQTAVQLFKLLDKYRPETPEAKKARLRARAEKKAATKQDAPTKRPNTVRAGVNTGVKLGEQTKAQL
• ORF Type: internal

Annotations of Ll_transcript_334167

• Blastp: 60S ribosomal protein L7a from Takifugu with 73.33% of identity
• Blastx: 60S ribosomal protein L7a from Sophophora with 74.17% of identity
• Eggnog: (ribosomal) protein(COG1358)
• Kegg: Link to kegg annotations (101064977)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013447916.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;