Protein coding transcript 52140

• Transcript: Ll_transcript_509571
• CDS coordinates: 3-539 (+)
• Peptide sequence: LPLSLDGEGLKKGTRVGQGAFREVAAYILDHPSSGRRSLFGDEKGFAGIPPTAMVKCLHKGFNHPENFTAKIGSLQLFMENSGSCEDMGPGAFPVNEVHKITVLDLRLANADRHAGNILISKEEENDQAVLIPIDHGYCLPTSFEDCTFEWLYWPQARQPYSPETIDYIKSLDAEEDIA
• ORF Type: internal

Annotations of Ll_transcript_509571

• Blastp: Phosphatidylinositol 4-kinase gamma 4 from Arabidopsis with 75.28% of identity
• Blastx: Phosphatidylinositol 4-kinase gamma 4 from Arabidopsis with 75.28% of identity
• Eggnog: Phosphatidylinositol 4-kinase type(ENOG410XP06)
• Kegg: Link to kegg annotations (AT2G46500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456298.1)
• Pfam: Phosphatidylinositol 3- and 4-kinase (PF00454.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;