Protein coding transcript 52156

• Transcript: Ll_transcript_509435
• CDS coordinates: 151-870 (+)
• Peptide sequence: MADTVLDIQDSGWDELRKEARKIEGDIDVKLSSYAKLGTRFTQRGYVDSGSPPLASSRSWKSMEMEIQSLLEKLLDINDSMSRCAASAAPATSVNQKLARHRDILHEFTQEFRRIKGNMNSMREHAELLTSVRDDISEYKTSGTTSPRMQLLRERANIHGSISHIDDVISQAQATRAVLGSQRALFGDVQGKVKVLSDKFPIIRSLLGSIRRKRSRDTLILSAVIAACTLFLIIYWLSK*
• ORF Type: complete

Annotations of Ll_transcript_509435

• Blastp: Golgi SNAP receptor complex member 1-2 from Arabidopsis with 78.6% of identity
• Blastx: Golgi SNAP receptor complex member 1-2 from Arabidopsis with 78.6% of identity
• Eggnog: Involved in transport from the ER to the Golgi apparatus as well as in intra-Golgi transport. It belongs to a super-family of proteins called t-SNAREs or soluble NSF (N-ethylmaleimide- sensitive factor) attachment protein receptor (By similarity)(ENOG410YI1X)
• Kegg: Link to kegg annotations (AT2G45200)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460704.1)
• Pfam: Snare region anchored in the vesicle membrane C-terminus (PF12352.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;