Transcript | Ll_transcript_509437 |
---|---|
CDS coordinates | 151-579 (+) |
Peptide sequence | MADTVLDIQDSGWDELRKEARKIEGDIDVKLSSYAKLGTRFTQRGYVDSGSPPLASSRSWKSMEMEIQSLLEKLLDINDSMSRCAASAAPATSVNQKLARHRDILHEFTQVCCISLLFHVTLFQSQNKNESLTLSTLKTISL* |
ORF Type | complete |
Blastp | Golgi SNAP receptor complex member 1-2 from Arabidopsis with 71.09% of identity |
---|---|
Blastx | Golgi SNAP receptor complex member 1-2 from Arabidopsis with 71.09% of identity |
Eggnog | Involved in transport from the ER to the Golgi apparatus as well as in intra-Golgi transport. It belongs to a super-family of proteins called t-SNAREs or soluble NSF (N-ethylmaleimide- sensitive factor) attachment protein receptor (By similarity)(ENOG410YI1X) |
Kegg | Link to kegg annotations (AT2G45200) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460702.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer